Anti ALX3 pAb (ATL-HPA074290)

Atlas Antibodies

Catalog No: ATL-HPA074290-25

• 

Product Description

Protein Description: ALX homeobox 3
Gene Name: ALX3
Alternative Gene Name: FND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014603: 87%, ENSRNOG00000018290: 85%
Entrez Gene ID: 257
Uniprot ID: O95076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN
• Gene Sequence: PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN
• Gene ID - Mouse: ENSMUSG00000014603
• Gene ID - Rat: ENSRNOG00000018290
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.