Protein Description: ALX homeobox 3
Gene Name: ALX3
Alternative Gene Name: FND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014603: 87%, ENSRNOG00000018290: 85%
Entrez Gene ID: 257
Uniprot ID: O95076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALX3
Alternative Gene Name: FND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014603: 87%, ENSRNOG00000018290: 85%
Entrez Gene ID: 257
Uniprot ID: O95076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN |
| Documents & Links for Anti ALX3 pAb (ATL-HPA074290) | |
| Datasheet | Anti ALX3 pAb (ATL-HPA074290) Datasheet (External Link) |
| Vendor Page | Anti ALX3 pAb (ATL-HPA074290) at Atlas |
| Documents & Links for Anti ALX3 pAb (ATL-HPA074290) | |
| Datasheet | Anti ALX3 pAb (ATL-HPA074290) Datasheet (External Link) |
| Vendor Page | Anti ALX3 pAb (ATL-HPA074290) |