Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA078597-25

• 

Product Description

Protein Description: arachidonate lipoxygenase 3
Gene Name: ALOXE3
Alternative Gene Name: E-LOX, eLOX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020892: 86%, ENSRNOG00000007454: 86%
Entrez Gene ID: 59344
Uniprot ID: Q9BYJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS
• Gene Sequence: YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS
• Gene ID - Mouse: ENSMUSG00000020892
• Gene ID - Rat: ENSRNOG00000007454
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.