Protein Description: arachidonate lipoxygenase 3
Gene Name: ALOXE3
Alternative Gene Name: E-LOX, eLOX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020892: 86%, ENSRNOG00000007454: 86%
Entrez Gene ID: 59344
Uniprot ID: Q9BYJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALOXE3
Alternative Gene Name: E-LOX, eLOX3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020892: 86%, ENSRNOG00000007454: 86%
Entrez Gene ID: 59344
Uniprot ID: Q9BYJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YQWIEGYCTVELRPGTARTICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCVDQGDSS |
| Documents & Links for Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) | |
| Datasheet | Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) at Atlas |
| Documents & Links for Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) | |
| Datasheet | Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOXE3 pAb (ATL-HPA078597 w/enhanced validation) |