Protein Description: arachidonate 5-lipoxygenase
Gene Name: ALOX5
Alternative Gene Name: 5-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025701: 94%, ENSRNOG00000012972: 94%
Entrez Gene ID: 240
Uniprot ID: P09917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALOX5
Alternative Gene Name: 5-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025701: 94%, ENSRNOG00000012972: 94%
Entrez Gene ID: 240
Uniprot ID: P09917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY |
Documents & Links for Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) | |
Datasheet | Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) at Atlas |
Documents & Links for Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) | |
Datasheet | Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) |