Anti ALOX12 pAb (ATL-HPA064819)

Catalog No:
ATL-HPA064819-25
$303.00

Description

Product Description

Protein Description: arachidonate 12-lipoxygenase, 12S type
Gene Name: ALOX12
Alternative Gene Name: 12S-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000320: 88%, ENSRNOG00000027037: 86%
Entrez Gene ID: 239
Uniprot ID: P18054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS
Gene Sequence PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS
Gene ID - Mouse ENSMUSG00000000320
Gene ID - Rat ENSRNOG00000027037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ALOX12 pAb (ATL-HPA064819)
Datasheet Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA064819) at Atlas Antibodies

Documents & Links for Anti ALOX12 pAb (ATL-HPA064819)
Datasheet Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA064819)

Product Description

Protein Description: arachidonate 12-lipoxygenase, 12S type
Gene Name: ALOX12
Alternative Gene Name: 12S-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000320: 88%, ENSRNOG00000027037: 86%
Entrez Gene ID: 239
Uniprot ID: P18054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS
Gene Sequence PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS
Gene ID - Mouse ENSMUSG00000000320
Gene ID - Rat ENSRNOG00000027037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ALOX12 pAb (ATL-HPA064819)
Datasheet Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA064819) at Atlas Antibodies

Documents & Links for Anti ALOX12 pAb (ATL-HPA064819)
Datasheet Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA064819)