Protein Description: arachidonate 12-lipoxygenase, 12S type
Gene Name: ALOX12
Alternative Gene Name: 12S-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000320: 88%, ENSRNOG00000027037: 86%
Entrez Gene ID: 239
Uniprot ID: P18054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALOX12
Alternative Gene Name: 12S-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000320: 88%, ENSRNOG00000027037: 86%
Entrez Gene ID: 239
Uniprot ID: P18054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PGDNALDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLS |
| Documents & Links for Anti ALOX12 pAb (ATL-HPA064819) | |
| Datasheet | Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link) |
| Vendor Page | Anti ALOX12 pAb (ATL-HPA064819) at Atlas |
| Documents & Links for Anti ALOX12 pAb (ATL-HPA064819) | |
| Datasheet | Anti ALOX12 pAb (ATL-HPA064819) Datasheet (External Link) |
| Vendor Page | Anti ALOX12 pAb (ATL-HPA064819) |