Anti ALKBH6 pAb (ATL-HPA074340)

Atlas Antibodies

Catalog No: ATL-HPA074340-25

• 

Product Description

Protein Description: alkB homolog 6
Gene Name: ALKBH6
Alternative Gene Name: MGC15677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042831: 95%, ENSRNOG00000047943: 95%
Entrez Gene ID: 84964
Uniprot ID: Q3KRA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQ
• Gene Sequence: NWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMPHEDGPLYYPTVSTISLGSHTVLDFYEPRRPEDDDPTEQ
• Gene ID - Mouse: ENSMUSG00000042831
• Gene ID - Rat: ENSRNOG00000047943
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.