Protein Description: alkB homolog 6
Gene Name: ALKBH6
Alternative Gene Name: MGC15677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042831: 68%, ENSRNOG00000047943: 67%
Entrez Gene ID: 84964
Uniprot ID: Q3KRA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALKBH6
Alternative Gene Name: MGC15677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042831: 68%, ENSRNOG00000047943: 67%
Entrez Gene ID: 84964
Uniprot ID: Q3KRA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS |
| Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835) | |
| Datasheet | Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link) |
| Vendor Page | Anti ALKBH6 pAb (ATL-HPA073835) at Atlas |
| Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835) | |
| Datasheet | Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link) |
| Vendor Page | Anti ALKBH6 pAb (ATL-HPA073835) |