Anti ALG6 pAb (ATL-HPA076130)

Catalog No:
ATL-HPA076130-25
$447.00

Description

Product Description

Protein Description: ALG6, alpha-1,3-glucosyltransferase
Gene Name: ALG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073792: 96%, ENSRNOG00000009045: 98%
Entrez Gene ID: 29929
Uniprot ID: Q9Y672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA
Gene Sequence SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA
Gene ID - Mouse ENSMUSG00000073792
Gene ID - Rat ENSRNOG00000009045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ALG6 pAb (ATL-HPA076130)
Datasheet Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA076130) at Atlas Antibodies

Documents & Links for Anti ALG6 pAb (ATL-HPA076130)
Datasheet Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA076130)

Product Description

Protein Description: ALG6, alpha-1,3-glucosyltransferase
Gene Name: ALG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073792: 96%, ENSRNOG00000009045: 98%
Entrez Gene ID: 29929
Uniprot ID: Q9Y672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA
Gene Sequence SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA
Gene ID - Mouse ENSMUSG00000073792
Gene ID - Rat ENSRNOG00000009045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ALG6 pAb (ATL-HPA076130)
Datasheet Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA076130) at Atlas Antibodies

Documents & Links for Anti ALG6 pAb (ATL-HPA076130)
Datasheet Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA076130)