Description
Product Description
Protein Description: ALG6, alpha-1,3-glucosyltransferase
Gene Name: ALG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073792: 96%, ENSRNOG00000009045: 98%
Entrez Gene ID: 29929
Uniprot ID: Q9Y672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073792: 96%, ENSRNOG00000009045: 98%
Entrez Gene ID: 29929
Uniprot ID: Q9Y672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA |
Gene Sequence | SGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTA |
Gene ID - Mouse | ENSMUSG00000073792 |
Gene ID - Rat | ENSRNOG00000009045 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ALG6 pAb (ATL-HPA076130) | |
Datasheet | Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link) |
Vendor Page | Anti ALG6 pAb (ATL-HPA076130) at Atlas Antibodies |
Documents & Links for Anti ALG6 pAb (ATL-HPA076130) | |
Datasheet | Anti ALG6 pAb (ATL-HPA076130) Datasheet (External Link) |
Vendor Page | Anti ALG6 pAb (ATL-HPA076130) |