![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101017/181051/atl-hpa072759_anti-aldh4a1-pab-atl-hpa072759_62719__50609.1681137288.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: aldehyde dehydrogenase 4 family member A1
Gene Name: ALDH4A1
Alternative Gene Name: ALDH4, P5CDh
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028737: 92%, ENSRNOG00000061876: 89%
Entrez Gene ID: 8659
Uniprot ID: P30038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALDH4A1
Alternative Gene Name: ALDH4, P5CDh
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028737: 92%, ENSRNOG00000061876: 89%
Entrez Gene ID: 8659
Uniprot ID: P30038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKE |
| Documents & Links for Anti ALDH4A1 pAb (ATL-HPA072759) | |
| Datasheet | Anti ALDH4A1 pAb (ATL-HPA072759) Datasheet (External Link) |
| Vendor Page | Anti ALDH4A1 pAb (ATL-HPA072759) at Atlas |
| Documents & Links for Anti ALDH4A1 pAb (ATL-HPA072759) | |
| Datasheet | Anti ALDH4A1 pAb (ATL-HPA072759) Datasheet (External Link) |
| Vendor Page | Anti ALDH4A1 pAb (ATL-HPA072759) |