Anti ALDH4A1 pAb (ATL-HPA072759)

Atlas Antibodies

Catalog No: ATL-HPA072759-100

• 
• 

Product Description

Protein Description: aldehyde dehydrogenase 4 family member A1
Gene Name: ALDH4A1
Alternative Gene Name: ALDH4, P5CDh
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028737: 92%, ENSRNOG00000061876: 89%
Entrez Gene ID: 8659
Uniprot ID: P30038
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKE
• Gene Sequence: LSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVVQEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKE
• Gene ID - Mouse: ENSMUSG00000028737
• Gene ID - Rat: ENSRNOG00000061876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.