Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063783-25

• 
• 
• 

Product Description

Protein Description: aldehyde dehydrogenase 3 family, member A1
Gene Name: ALDH3A1
Alternative Gene Name: ALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019102: 67%, ENSRNOG00000002331: 70%
Entrez Gene ID: 218
Uniprot ID: P30838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
• Gene Sequence: LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL
• Gene ID - Mouse: ENSMUSG00000019102
• Gene ID - Rat: ENSRNOG00000002331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.