Protein Description: aldehyde dehydrogenase 3 family, member A1
Gene Name: ALDH3A1
Alternative Gene Name: ALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019102: 67%, ENSRNOG00000002331: 70%
Entrez Gene ID: 218
Uniprot ID: P30838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALDH3A1
Alternative Gene Name: ALDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019102: 67%, ENSRNOG00000002331: 70%
Entrez Gene ID: 218
Uniprot ID: P30838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPL |
Documents & Links for Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) | |
Datasheet | Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) at Atlas |
Documents & Links for Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) | |
Datasheet | Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ALDH3A1 pAb (ATL-HPA063783 w/enhanced validation) |