![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101727/181888/atl-hpa077080_anti-aldh1b1-pab-atl-hpa077080_63556__52181.1681138318.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: aldehyde dehydrogenase 1 family member B1
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 94%, ENSRNOG00000011497: 90%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALDH1B1
Alternative Gene Name: ALDH5, ALDHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035561: 94%, ENSRNOG00000011497: 90%
Entrez Gene ID: 219
Uniprot ID: P30837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQK |
| Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080) | |
| Datasheet | Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link) |
| Vendor Page | Anti ALDH1B1 pAb (ATL-HPA077080) at Atlas |
| Documents & Links for Anti ALDH1B1 pAb (ATL-HPA077080) | |
| Datasheet | Anti ALDH1B1 pAb (ATL-HPA077080) Datasheet (External Link) |
| Vendor Page | Anti ALDH1B1 pAb (ATL-HPA077080) |