Protein Description: aminolevulinate, delta-, synthase 2
Gene Name: ALAS2
Alternative Gene Name: ASB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025270: 91%, ENSRNOG00000000167: 83%
Entrez Gene ID: 212
Uniprot ID: P22557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ALAS2
Alternative Gene Name: ASB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025270: 91%, ENSRNOG00000000167: 83%
Entrez Gene ID: 212
Uniprot ID: P22557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS |
| Documents & Links for Anti ALAS2 pAb (ATL-HPA001638) | |
| Datasheet | Anti ALAS2 pAb (ATL-HPA001638) Datasheet (External Link) |
| Vendor Page | Anti ALAS2 pAb (ATL-HPA001638) at Atlas |
| Documents & Links for Anti ALAS2 pAb (ATL-HPA001638) | |
| Datasheet | Anti ALAS2 pAb (ATL-HPA001638) Datasheet (External Link) |
| Vendor Page | Anti ALAS2 pAb (ATL-HPA001638) |