Protein Description: aldo-keto reductase family 7, member A2
Gene Name: AKR7A2
Alternative Gene Name: AFAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028743: 97%, ENSRNOG00000017780: 95%
Entrez Gene ID: 8574
Uniprot ID: O43488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AKR7A2
Alternative Gene Name: AFAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028743: 97%, ENSRNOG00000017780: 95%
Entrez Gene ID: 8574
Uniprot ID: O43488
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ |
| Documents & Links for Anti AKR7A2 pAb (ATL-HPA064638) | |
| Datasheet | Anti AKR7A2 pAb (ATL-HPA064638) Datasheet (External Link) |
| Vendor Page | Anti AKR7A2 pAb (ATL-HPA064638) at Atlas |
| Documents & Links for Anti AKR7A2 pAb (ATL-HPA064638) | |
| Datasheet | Anti AKR7A2 pAb (ATL-HPA064638) Datasheet (External Link) |
| Vendor Page | Anti AKR7A2 pAb (ATL-HPA064638) |