Protein Description: adenylate kinase 6
Gene Name: AK6
Alternative Gene Name: CINAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078941: 83%, ENSRNOG00000039848: 80%
Entrez Gene ID: 102157402
Uniprot ID: Q9Y3D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AK6
Alternative Gene Name: CINAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078941: 83%, ENSRNOG00000039848: 80%
Entrez Gene ID: 102157402
Uniprot ID: Q9Y3D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIE |
Documents & Links for Anti AK6 pAb (ATL-HPA070217) | |
Datasheet | Anti AK6 pAb (ATL-HPA070217) Datasheet (External Link) |
Vendor Page | Anti AK6 pAb (ATL-HPA070217) at Atlas |
Documents & Links for Anti AK6 pAb (ATL-HPA070217) | |
Datasheet | Anti AK6 pAb (ATL-HPA070217) Datasheet (External Link) |
Vendor Page | Anti AK6 pAb (ATL-HPA070217) |