Protein Description: apoptosis inducing factor, mitochondria associated 2
Gene Name: AIFM2
Alternative Gene Name: AMID, FLJ14497, PRG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020085: 94%, ENSRNOG00000059445: 94%
Entrez Gene ID: 84883
Uniprot ID: Q9BRQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AIFM2
Alternative Gene Name: AMID, FLJ14497, PRG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020085: 94%, ENSRNOG00000059445: 94%
Entrez Gene ID: 84883
Uniprot ID: Q9BRQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE |
Documents & Links for Anti AIFM2 pAb (ATL-HPA075576) | |
Datasheet | Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link) |
Vendor Page | Anti AIFM2 pAb (ATL-HPA075576) at Atlas |
Documents & Links for Anti AIFM2 pAb (ATL-HPA075576) | |
Datasheet | Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link) |
Vendor Page | Anti AIFM2 pAb (ATL-HPA075576) |