Anti AIFM2 pAb (ATL-HPA075576)

Catalog No:
ATL-HPA075576-25
$447.00

Description

Product Description

Protein Description: apoptosis inducing factor, mitochondria associated 2
Gene Name: AIFM2
Alternative Gene Name: AMID, FLJ14497, PRG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020085: 94%, ENSRNOG00000059445: 94%
Entrez Gene ID: 84883
Uniprot ID: Q9BRQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE
Gene Sequence AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE
Gene ID - Mouse ENSMUSG00000020085
Gene ID - Rat ENSRNOG00000059445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AIFM2 pAb (ATL-HPA075576)
Datasheet Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link)
Vendor Page Anti AIFM2 pAb (ATL-HPA075576) at Atlas Antibodies

Documents & Links for Anti AIFM2 pAb (ATL-HPA075576)
Datasheet Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link)
Vendor Page Anti AIFM2 pAb (ATL-HPA075576)

Product Description

Protein Description: apoptosis inducing factor, mitochondria associated 2
Gene Name: AIFM2
Alternative Gene Name: AMID, FLJ14497, PRG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020085: 94%, ENSRNOG00000059445: 94%
Entrez Gene ID: 84883
Uniprot ID: Q9BRQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE
Gene Sequence AGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTE
Gene ID - Mouse ENSMUSG00000020085
Gene ID - Rat ENSRNOG00000059445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AIFM2 pAb (ATL-HPA075576)
Datasheet Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link)
Vendor Page Anti AIFM2 pAb (ATL-HPA075576) at Atlas Antibodies

Documents & Links for Anti AIFM2 pAb (ATL-HPA075576)
Datasheet Anti AIFM2 pAb (ATL-HPA075576) Datasheet (External Link)
Vendor Page Anti AIFM2 pAb (ATL-HPA075576)