Description
Product Description
Protein Description: ATP/GTP binding protein 1
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 94%, ENSRNOG00000018651: 93%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 94%, ENSRNOG00000018651: 93%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSE |
Gene Sequence | KRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSE |
Gene ID - Mouse | ENSMUSG00000021557 |
Gene ID - Rat | ENSRNOG00000018651 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AGTPBP1 pAb (ATL-HPA071094) | |
Datasheet | Anti AGTPBP1 pAb (ATL-HPA071094) Datasheet (External Link) |
Vendor Page | Anti AGTPBP1 pAb (ATL-HPA071094) at Atlas Antibodies |
Documents & Links for Anti AGTPBP1 pAb (ATL-HPA071094) | |
Datasheet | Anti AGTPBP1 pAb (ATL-HPA071094) Datasheet (External Link) |
Vendor Page | Anti AGTPBP1 pAb (ATL-HPA071094) |