Protein Description: ATP/GTP binding protein 1
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 94%, ENSRNOG00000018651: 93%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGTPBP1
Alternative Gene Name: CCP1, KIAA1035, Nna1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021557: 94%, ENSRNOG00000018651: 93%
Entrez Gene ID: 23287
Uniprot ID: Q9UPW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KRLTSPLEYNLPSSLLDFENDLIESSCKVTSPTTYVLDEDEPRFLEEVDYSAESNDELDIELAENVGDYEPSAQEEVLSDSE |
| Documents & Links for Anti AGTPBP1 pAb (ATL-HPA071094) | |
| Datasheet | Anti AGTPBP1 pAb (ATL-HPA071094) Datasheet (External Link) |
| Vendor Page | Anti AGTPBP1 pAb (ATL-HPA071094) at Atlas |
| Documents & Links for Anti AGTPBP1 pAb (ATL-HPA071094) | |
| Datasheet | Anti AGTPBP1 pAb (ATL-HPA071094) Datasheet (External Link) |
| Vendor Page | Anti AGTPBP1 pAb (ATL-HPA071094) |