Anti AGPAT1 pAb (ATL-HPA073355)

Catalog No:
ATL-HPA073355-25
$303.00

Description

Product Description

Protein Description: 1-acylglycerol-3-phosphate O-acyltransferase 1
Gene Name: AGPAT1
Alternative Gene Name: LPAAT-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034254: 89%, ENSRNOG00000000437: 93%
Entrez Gene ID: 10554
Uniprot ID: Q99943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene Sequence GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene ID - Mouse ENSMUSG00000034254
Gene ID - Rat ENSRNOG00000000437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355)
Datasheet Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA073355) at Atlas Antibodies

Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355)
Datasheet Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA073355)

Citations

Citations for Anti AGPAT1 pAb (ATL-HPA073355) – 1 Found
Vessby, Johan; Wisniewski, Jacek R; Lindskog, Cecilia; Eriksson, Niclas; Gabrysch, Katja; Zettl, Katharina; Wanders, Alkwin; Carlson, Marie; Rorsman, Fredrik; Åberg, Mikael. AGPAT1 as a Novel Colonic Biomarker for Discriminating Between Ulcerative Colitis With and Without Primary Sclerosing Cholangitis. Clinical And Translational Gastroenterology. 2022;13(5):e00486.  PubMed

Product Description

Protein Description: 1-acylglycerol-3-phosphate O-acyltransferase 1
Gene Name: AGPAT1
Alternative Gene Name: LPAAT-alpha
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034254: 89%, ENSRNOG00000000437: 93%
Entrez Gene ID: 10554
Uniprot ID: Q99943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene Sequence GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Gene ID - Mouse ENSMUSG00000034254
Gene ID - Rat ENSRNOG00000000437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355)
Datasheet Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA073355) at Atlas Antibodies

Documents & Links for Anti AGPAT1 pAb (ATL-HPA073355)
Datasheet Anti AGPAT1 pAb (ATL-HPA073355) Datasheet (External Link)
Vendor Page Anti AGPAT1 pAb (ATL-HPA073355)

Citations

Citations for Anti AGPAT1 pAb (ATL-HPA073355) – 1 Found
Vessby, Johan; Wisniewski, Jacek R; Lindskog, Cecilia; Eriksson, Niclas; Gabrysch, Katja; Zettl, Katharina; Wanders, Alkwin; Carlson, Marie; Rorsman, Fredrik; Åberg, Mikael. AGPAT1 as a Novel Colonic Biomarker for Discriminating Between Ulcerative Colitis With and Without Primary Sclerosing Cholangitis. Clinical And Translational Gastroenterology. 2022;13(5):e00486.  PubMed