Description
Product Description
Protein Description: acylglycerol kinase
Gene Name: AGK
Alternative Gene Name: FLJ10842, MULK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029916: 93%, ENSRNOG00000011509: 90%
Entrez Gene ID: 55750
Uniprot ID: Q53H12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGK
Alternative Gene Name: FLJ10842, MULK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029916: 93%, ENSRNOG00000011509: 90%
Entrez Gene ID: 55750
Uniprot ID: Q53H12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQ |
Gene Sequence | IVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQ |
Gene ID - Mouse | ENSMUSG00000029916 |
Gene ID - Rat | ENSRNOG00000011509 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti AGK pAb (ATL-HPA053471) | |
Datasheet | Anti AGK pAb (ATL-HPA053471) Datasheet (External Link) |
Vendor Page | Anti AGK pAb (ATL-HPA053471) at Atlas Antibodies |
Documents & Links for Anti AGK pAb (ATL-HPA053471) | |
Datasheet | Anti AGK pAb (ATL-HPA053471) Datasheet (External Link) |
Vendor Page | Anti AGK pAb (ATL-HPA053471) |