Protein Description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Gene Name: AGAP2
Alternative Gene Name: CENTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 99%, ENSRNOG00000025584: 100%
Entrez Gene ID: 116986
Uniprot ID: Q99490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGAP2
Alternative Gene Name: CENTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025422: 99%, ENSRNOG00000025584: 100%
Entrez Gene ID: 116986
Uniprot ID: Q99490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDS |
Documents & Links for Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) | |
Datasheet | Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) at Atlas |
Documents & Links for Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) | |
Datasheet | Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AGAP2 pAb (ATL-HPA075831 w/enhanced validation) |