Protein Description: afamin
Gene Name: AFM
Alternative Gene Name: ALB2, ALBA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029369: 71%, ENSRNOG00000002878: 71%
Entrez Gene ID: 173
Uniprot ID: P43652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AFM
Alternative Gene Name: ALB2, ALBA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029369: 71%, ENSRNOG00000002878: 71%
Entrez Gene ID: 173
Uniprot ID: P43652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | INSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEEL |
Gene Sequence | INSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEEL |
Gene ID - Mouse | ENSMUSG00000029369 |
Gene ID - Rat | ENSRNOG00000002878 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AFM pAb (ATL-HPA017006 w/enhanced validation) | |
Datasheet | Anti AFM pAb (ATL-HPA017006 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AFM pAb (ATL-HPA017006 w/enhanced validation) at Atlas |
Documents & Links for Anti AFM pAb (ATL-HPA017006 w/enhanced validation) | |
Datasheet | Anti AFM pAb (ATL-HPA017006 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AFM pAb (ATL-HPA017006 w/enhanced validation) |