Protein Description: AE binding protein 1
Gene Name: AEBP1
Alternative Gene Name: ACLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020473: 75%, ENSRNOG00000013720: 77%
Entrez Gene ID: 165
Uniprot ID: Q8IUX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AEBP1
Alternative Gene Name: ACLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020473: 75%, ENSRNOG00000013720: 77%
Entrez Gene ID: 165
Uniprot ID: Q8IUX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH |
| Documents & Links for Anti AEBP1 pAb (ATL-HPA064970) | |
| Datasheet | Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link) |
| Vendor Page | Anti AEBP1 pAb (ATL-HPA064970) at Atlas |
| Documents & Links for Anti AEBP1 pAb (ATL-HPA064970) | |
| Datasheet | Anti AEBP1 pAb (ATL-HPA064970) Datasheet (External Link) |
| Vendor Page | Anti AEBP1 pAb (ATL-HPA064970) |
| Citations for Anti AEBP1 pAb (ATL-HPA064970) – 1 Found |
| Caetano, Ana J; Yianni, Val; Volponi, Ana; Booth, Veronica; D'Agostino, Eleanor M; Sharpe, Paul. Defining human mesenchymal and epithelial heterogeneity in response to oral inflammatory disease. Elife. 2021;10( 33393902) PubMed |