Description
Product Description
Protein Description: adrenoceptor alpha 2B
Gene Name: ADRA2B
Alternative Gene Name: ADRA2L1, ADRA2RL1, ADRARL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058620: 78%, ENSRNOG00000013887: 81%
Entrez Gene ID: 151
Uniprot ID: P18089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADRA2B
Alternative Gene Name: ADRA2L1, ADRA2RL1, ADRARL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058620: 78%, ENSRNOG00000013887: 81%
Entrez Gene ID: 151
Uniprot ID: P18089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF |
Gene Sequence | SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF |
Gene ID - Mouse | ENSMUSG00000058620 |
Gene ID - Rat | ENSRNOG00000013887 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADRA2B pAb (ATL-HPA074948) | |
Datasheet | Anti ADRA2B pAb (ATL-HPA074948) Datasheet (External Link) |
Vendor Page | Anti ADRA2B pAb (ATL-HPA074948) at Atlas Antibodies |
Documents & Links for Anti ADRA2B pAb (ATL-HPA074948) | |
Datasheet | Anti ADRA2B pAb (ATL-HPA074948) Datasheet (External Link) |
Vendor Page | Anti ADRA2B pAb (ATL-HPA074948) |