Anti ADRA2B pAb (ATL-HPA074948)

Atlas Antibodies

Catalog No: ATL-HPA074948-25

• 

Product Description

Protein Description: adrenoceptor alpha 2B
Gene Name: ADRA2B
Alternative Gene Name: ADRA2L1, ADRA2RL1, ADRARL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058620: 78%, ENSRNOG00000013887: 81%
Entrez Gene ID: 151
Uniprot ID: P18089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
• Gene Sequence: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF
• Gene ID - Mouse: ENSMUSG00000058620
• Gene ID - Rat: ENSRNOG00000013887
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.