Protein Description: adrenoceptor alpha 1B
Gene Name: ADRA1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050541: 96%, ENSRNOG00000060087: 94%
Entrez Gene ID: 147
Uniprot ID: P35368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADRA1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050541: 96%, ENSRNOG00000060087: 94%
Entrez Gene ID: 147
Uniprot ID: P35368
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVG |
| Documents & Links for Anti ADRA1B pAb (ATL-HPA074416) | |
| Datasheet | Anti ADRA1B pAb (ATL-HPA074416) Datasheet (External Link) |
| Vendor Page | Anti ADRA1B pAb (ATL-HPA074416) at Atlas |
| Documents & Links for Anti ADRA1B pAb (ATL-HPA074416) | |
| Datasheet | Anti ADRA1B pAb (ATL-HPA074416) Datasheet (External Link) |
| Vendor Page | Anti ADRA1B pAb (ATL-HPA074416) |