Protein Description: ADP-ribosylhydrolase like 1
Gene Name: ADPRHL1
Alternative Gene Name: ARH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031448: 81%, ENSRNOG00000062013: 81%
Entrez Gene ID: 113622
Uniprot ID: Q8NDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADPRHL1
Alternative Gene Name: ARH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031448: 81%, ENSRNOG00000062013: 81%
Entrez Gene ID: 113622
Uniprot ID: Q8NDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV |
| Documents & Links for Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) | |
| Datasheet | Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) at Atlas |
| Documents & Links for Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) | |
| Datasheet | Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) |