Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation)

Catalog No:
ATL-HPA072123-25
$447.00

Description

Product Description

Protein Description: ADP-ribosylhydrolase like 1
Gene Name: ADPRHL1
Alternative Gene Name: ARH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031448: 81%, ENSRNOG00000062013: 81%
Entrez Gene ID: 113622
Uniprot ID: Q8NDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV
Gene Sequence NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV
Gene ID - Mouse ENSMUSG00000031448
Gene ID - Rat ENSRNOG00000062013
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation)
Datasheet Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation)

Product Description

Protein Description: ADP-ribosylhydrolase like 1
Gene Name: ADPRHL1
Alternative Gene Name: ARH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031448: 81%, ENSRNOG00000062013: 81%
Entrez Gene ID: 113622
Uniprot ID: Q8NDY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV
Gene Sequence NVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWCLDDLYREMVRCYV
Gene ID - Mouse ENSMUSG00000031448
Gene ID - Rat ENSRNOG00000062013
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation)
Datasheet Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADPRHL1 pAb (ATL-HPA072123 w/enhanced validation)