Protein Description: ADP-ribosylarginine hydrolase
Gene Name: ADPRH
Alternative Gene Name: ARH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002844: 75%, ENSRNOG00000027260: 78%
Entrez Gene ID: 141
Uniprot ID: P54922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADPRH
Alternative Gene Name: ARH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002844: 75%, ENSRNOG00000027260: 78%
Entrez Gene ID: 141
Uniprot ID: P54922
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDC |
| Gene Sequence | YYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDC |
| Gene ID - Mouse | ENSMUSG00000002844 |
| Gene ID - Rat | ENSRNOG00000027260 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ADPRH pAb (ATL-HPA036961) | |
| Datasheet | Anti ADPRH pAb (ATL-HPA036961) Datasheet (External Link) |
| Vendor Page | Anti ADPRH pAb (ATL-HPA036961) at Atlas |
| Documents & Links for Anti ADPRH pAb (ATL-HPA036961) | |
| Datasheet | Anti ADPRH pAb (ATL-HPA036961) Datasheet (External Link) |
| Vendor Page | Anti ADPRH pAb (ATL-HPA036961) |