Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA075997-25

• 

Product Description

Protein Description: adenosine A2a receptor
Gene Name: ADORA2A
Alternative Gene Name: ADORA2, RDC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020178: 52%, ENSRNOG00000001302: 44%
Entrez Gene ID: 135
Uniprot ID: P29274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
• Gene Sequence: PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD
• Gene ID - Mouse: ENSMUSG00000020178
• Gene ID - Rat: ENSRNOG00000001302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.