Protein Description: adenosine A2a receptor
Gene Name: ADORA2A
Alternative Gene Name: ADORA2, RDC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020178: 52%, ENSRNOG00000001302: 44%
Entrez Gene ID: 135
Uniprot ID: P29274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADORA2A
Alternative Gene Name: ADORA2, RDC8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020178: 52%, ENSRNOG00000001302: 44%
Entrez Gene ID: 135
Uniprot ID: P29274
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD |
Documents & Links for Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) | |
Datasheet | Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) at Atlas |
Documents & Links for Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) | |
Datasheet | Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADORA2A pAb (ATL-HPA075997 w/enhanced validation) |