Description
Product Description
Protein Description: adrenomedullin
Gene Name: ADM
Alternative Gene Name: AM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030790: 61%, ENSRNOG00000027030: 64%
Entrez Gene ID: 133
Uniprot ID: P35318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADM
Alternative Gene Name: AM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030790: 61%, ENSRNOG00000027030: 64%
Entrez Gene ID: 133
Uniprot ID: P35318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS |
Gene Sequence | ADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRS |
Gene ID - Mouse | ENSMUSG00000030790 |
Gene ID - Rat | ENSRNOG00000027030 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADM pAb (ATL-HPA068955) | |
Datasheet | Anti ADM pAb (ATL-HPA068955) Datasheet (External Link) |
Vendor Page | Anti ADM pAb (ATL-HPA068955) at Atlas Antibodies |
Documents & Links for Anti ADM pAb (ATL-HPA068955) | |
Datasheet | Anti ADM pAb (ATL-HPA068955) Datasheet (External Link) |
Vendor Page | Anti ADM pAb (ATL-HPA068955) |