![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101439/181545/atl-hpa075222_anti-adk-pab-atl-hpa075222_63213__09046.1681137897.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: adenosine kinase
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 89%, ENSRNOG00000012325: 85%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADK
Alternative Gene Name: AK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039197: 89%, ENSRNOG00000012325: 85%
Entrez Gene ID: 132
Uniprot ID: P55263
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD |
| Documents & Links for Anti ADK pAb (ATL-HPA075222) | |
| Datasheet | Anti ADK pAb (ATL-HPA075222) Datasheet (External Link) |
| Vendor Page | Anti ADK pAb (ATL-HPA075222) at Atlas |
| Documents & Links for Anti ADK pAb (ATL-HPA075222) | |
| Datasheet | Anti ADK pAb (ATL-HPA075222) Datasheet (External Link) |
| Vendor Page | Anti ADK pAb (ATL-HPA075222) |