Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)

Catalog No:
ATL-HPA067946-25
$447.00

Description

Product Description

Protein Description: alcohol dehydrogenase 6 (class V)
Gene Name: ADH6
Alternative Gene Name: ADH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074206: 50%, ENSRNOG00000012436: 61%
Entrez Gene ID: 130
Uniprot ID: P28332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Gene Sequence AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Gene ID - Mouse ENSMUSG00000074206
Gene ID - Rat ENSRNOG00000012436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)
Datasheet Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)
Datasheet Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)

Product Description

Protein Description: alcohol dehydrogenase 6 (class V)
Gene Name: ADH6
Alternative Gene Name: ADH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074206: 50%, ENSRNOG00000012436: 61%
Entrez Gene ID: 130
Uniprot ID: P28332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Gene Sequence AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG
Gene ID - Mouse ENSMUSG00000074206
Gene ID - Rat ENSRNOG00000012436
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)
Datasheet Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)
Datasheet Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation)