Protein Description: alcohol dehydrogenase 6 (class V)
Gene Name: ADH6
Alternative Gene Name: ADH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074206: 50%, ENSRNOG00000012436: 61%
Entrez Gene ID: 130
Uniprot ID: P28332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADH6
Alternative Gene Name: ADH-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074206: 50%, ENSRNOG00000012436: 61%
Entrez Gene ID: 130
Uniprot ID: P28332
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEG |
Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) | |
Datasheet | Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) at Atlas |
Documents & Links for Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) | |
Datasheet | Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADH6 pAb (ATL-HPA067946 w/enhanced validation) |