Protein Description: alcohol dehydrogenase 4 (class II), pi polypeptide
Gene Name: ADH4
Alternative Gene Name: ADH-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037797: 66%, ENSRNOG00000046357: 66%
Entrez Gene ID: 127
Uniprot ID: P08319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADH4
Alternative Gene Name: ADH-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037797: 66%, ENSRNOG00000046357: 66%
Entrez Gene ID: 127
Uniprot ID: P08319
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKGLTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALV |
Documents & Links for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) | |
Datasheet | Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) at Atlas |
Documents & Links for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) | |
Datasheet | Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) |
Citations for Anti ADH4 pAb (ATL-HPA020525 w/enhanced validation) – 2 Found |
Xiao, Yangyan; de Paiva, Cintia S; Yu, Zhiyuan; de Souza, Rodrigo G; Li, De-Quan; Pflugfelder, Stephen C. Goblet cell-produced retinoic acid suppresses CD86 expression and IL-12 production in bone marrow-derived cells. International Immunology. 2018;30(10):457-470. PubMed |
Fagerberg, Linn; Hallström, Björn M; Oksvold, Per; Kampf, Caroline; Djureinovic, Dijana; Odeberg, Jacob; Habuka, Masato; Tahmasebpoor, Simin; Danielsson, Angelika; Edlund, Karolina; Asplund, Anna; Sjöstedt, Evelina; Lundberg, Emma; Szigyarto, Cristina Al-Khalili; Skogs, Marie; Takanen, Jenny Ottosson; Berling, Holger; Tegel, Hanna; Mulder, Jan; Nilsson, Peter; Schwenk, Jochen M; Lindskog, Cecilia; Danielsson, Frida; Mardinoglu, Adil; Sivertsson, Asa; von Feilitzen, Kalle; Forsberg, Mattias; Zwahlen, Martin; Olsson, IngMarie; Navani, Sanjay; Huss, Mikael; Nielsen, Jens; Ponten, Fredrik; Uhlén, Mathias. Analysis of the human tissue-specific expression by genome-wide integration of transcriptomics and antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2014;13(2):397-406. PubMed |