Description
Product Description
Protein Description: adhesion G protein-coupled receptor G7
Gene Name: ADGRG7
Alternative Gene Name: FLJ14454, GPR128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022755: 67%, ENSRNOG00000001634: 70%
Entrez Gene ID: 84873
Uniprot ID: Q96K78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADGRG7
Alternative Gene Name: FLJ14454, GPR128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022755: 67%, ENSRNOG00000001634: 70%
Entrez Gene ID: 84873
Uniprot ID: Q96K78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAEN |
Gene Sequence | STSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAEN |
Gene ID - Mouse | ENSMUSG00000022755 |
Gene ID - Rat | ENSRNOG00000001634 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADGRG7 pAb (ATL-HPA056451) | |
Datasheet | Anti ADGRG7 pAb (ATL-HPA056451) Datasheet (External Link) |
Vendor Page | Anti ADGRG7 pAb (ATL-HPA056451) at Atlas Antibodies |
Documents & Links for Anti ADGRG7 pAb (ATL-HPA056451) | |
Datasheet | Anti ADGRG7 pAb (ATL-HPA056451) Datasheet (External Link) |
Vendor Page | Anti ADGRG7 pAb (ATL-HPA056451) |