Description
Product Description
Protein Description: adhesion G protein-coupled receptor D1
Gene Name: ADGRD1
Alternative Gene Name: DKFZp434B1272, GPR133, PGR25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044017: 87%, ENSRNOG00000023536: 87%
Entrez Gene ID: 283383
Uniprot ID: Q6QNK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADGRD1
Alternative Gene Name: DKFZp434B1272, GPR133, PGR25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044017: 87%, ENSRNOG00000023536: 87%
Entrez Gene ID: 283383
Uniprot ID: Q6QNK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WKTQGEQSRPIPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDY |
Gene Sequence | WKTQGEQSRPIPSAYGGQVISNGFKVCSSGGRGSVELYTRDNSMTWEASFSPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSRDY |
Gene ID - Mouse | ENSMUSG00000044017 |
Gene ID - Rat | ENSRNOG00000023536 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADGRD1 pAb (ATL-HPA076279) | |
Datasheet | Anti ADGRD1 pAb (ATL-HPA076279) Datasheet (External Link) |
Vendor Page | Anti ADGRD1 pAb (ATL-HPA076279) at Atlas Antibodies |
Documents & Links for Anti ADGRD1 pAb (ATL-HPA076279) | |
Datasheet | Anti ADGRD1 pAb (ATL-HPA076279) Datasheet (External Link) |
Vendor Page | Anti ADGRD1 pAb (ATL-HPA076279) |