Anti ADGRB2 pAb (ATL-HPA069175)

Atlas Antibodies

Catalog No: ATL-HPA069175-25

• 
• 

Product Description

Protein Description: adhesion G protein-coupled receptor B2
Gene Name: ADGRB2
Alternative Gene Name: BAI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028782: 94%, ENSRNOG00000014375: 96%
Entrez Gene ID: 576
Uniprot ID: O60241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
• Gene Sequence: CLVGPEGSLSFSPLPGNILVPMAASPGLGEPPPPQEANPVYMCGEGGLRQLDLTWLRPTEPGSEGDYMVLPRRTLSL
• Gene ID - Mouse: ENSMUSG00000028782
• Gene ID - Rat: ENSRNOG00000014375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.