Protein Description: ADCYAP receptor type I
Gene Name: ADCYAP1R1
Alternative Gene Name: PAC1, PAC1R, PACAPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029778: 87%, ENSRNOG00000012098: 89%
Entrez Gene ID: 117
Uniprot ID: P41586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADCYAP1R1
Alternative Gene Name: PAC1, PAC1R, PACAPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029778: 87%, ENSRNOG00000012098: 89%
Entrez Gene ID: 117
Uniprot ID: P41586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ |
Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739) | |
Datasheet | Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link) |
Vendor Page | Anti ADCYAP1R1 pAb (ATL-HPA030739) at Atlas |
Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739) | |
Datasheet | Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link) |
Vendor Page | Anti ADCYAP1R1 pAb (ATL-HPA030739) |