Anti ADCYAP1R1 pAb (ATL-HPA030739)

Catalog No:
ATL-HPA030739-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: ADCYAP receptor type I
Gene Name: ADCYAP1R1
Alternative Gene Name: PAC1, PAC1R, PACAPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029778: 87%, ENSRNOG00000012098: 89%
Entrez Gene ID: 117
Uniprot ID: P41586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Gene Sequence KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ
Gene ID - Mouse ENSMUSG00000029778
Gene ID - Rat ENSRNOG00000012098
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739)
Datasheet Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link)
Vendor Page Anti ADCYAP1R1 pAb (ATL-HPA030739) at Atlas Antibodies

Documents & Links for Anti ADCYAP1R1 pAb (ATL-HPA030739)
Datasheet Anti ADCYAP1R1 pAb (ATL-HPA030739) Datasheet (External Link)
Vendor Page Anti ADCYAP1R1 pAb (ATL-HPA030739)