Description
Product Description
Protein Description: adenylate cyclase 5
Gene Name: ADCY5
Alternative Gene Name: AC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022840: 79%, ENSRNOG00000002229: 77%
Entrez Gene ID: 111
Uniprot ID: O95622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADCY5
Alternative Gene Name: AC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022840: 79%, ENSRNOG00000002229: 77%
Entrez Gene ID: 111
Uniprot ID: O95622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF |
Gene Sequence | FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF |
Gene ID - Mouse | ENSMUSG00000022840 |
Gene ID - Rat | ENSRNOG00000002229 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADCY5 pAb (ATL-HPA077682) | |
Datasheet | Anti ADCY5 pAb (ATL-HPA077682) Datasheet (External Link) |
Vendor Page | Anti ADCY5 pAb (ATL-HPA077682) at Atlas Antibodies |
Documents & Links for Anti ADCY5 pAb (ATL-HPA077682) | |
Datasheet | Anti ADCY5 pAb (ATL-HPA077682) Datasheet (External Link) |
Vendor Page | Anti ADCY5 pAb (ATL-HPA077682) |