Protein Description: ADAMTS like 1
Gene Name: ADAMTSL1
Alternative Gene Name: ADAMTSR1, C9orf94, FLJ35283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066113: 83%, ENSRNOG00000006956: 83%
Entrez Gene ID: 92949
Uniprot ID: Q8N6G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTSL1
Alternative Gene Name: ADAMTSR1, C9orf94, FLJ35283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066113: 83%, ENSRNOG00000006956: 83%
Entrez Gene ID: 92949
Uniprot ID: Q8N6G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | REHFVIKLIGGNRKLVARPLSPRSEEEVLAGRKGGPKEALQTHKHQNGIFSNGSKAEKRGLAANPGSRYDDLVSRLL |
| Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA074973) | |
| Datasheet | Anti ADAMTSL1 pAb (ATL-HPA074973) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL1 pAb (ATL-HPA074973) at Atlas |
| Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA074973) | |
| Datasheet | Anti ADAMTSL1 pAb (ATL-HPA074973) Datasheet (External Link) |
| Vendor Page | Anti ADAMTSL1 pAb (ATL-HPA074973) |