Protein Description: ADAMTS-like 1
Gene Name: ADAMTSL1
Alternative Gene Name: ADAMTSR1, C9orf94, FLJ35283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066113: 90%, ENSRNOG00000006956: 89%
Entrez Gene ID: 92949
Uniprot ID: Q8N6G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTSL1
Alternative Gene Name: ADAMTSR1, C9orf94, FLJ35283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066113: 90%, ENSRNOG00000006956: 89%
Entrez Gene ID: 92949
Uniprot ID: Q8N6G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QVPTQLEDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS |
Gene ID - Mouse | ENSMUSG00000066113 |
Gene ID - Rat | ENSMUSG00000066113 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA057437) | |
Datasheet | Anti ADAMTSL1 pAb (ATL-HPA057437) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL1 pAb (ATL-HPA057437) at Atlas |
Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA057437) | |
Datasheet | Anti ADAMTSL1 pAb (ATL-HPA057437) Datasheet (External Link) |
Vendor Page | Anti ADAMTSL1 pAb (ATL-HPA057437) |