Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 8
Gene Name: ADAMTS8
Alternative Gene Name: ADAM-TS8, FLJ41712, METH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031994: 83%, ENSRNOG00000005574: 83%
Entrez Gene ID: 11095
Uniprot ID: Q9UP79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTS8
Alternative Gene Name: ADAM-TS8, FLJ41712, METH2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031994: 83%, ENSRNOG00000005574: 83%
Entrez Gene ID: 11095
Uniprot ID: Q9UP79
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVL |
| Documents & Links for Anti ADAMTS8 pAb (ATL-HPA066349) | |
| Datasheet | Anti ADAMTS8 pAb (ATL-HPA066349) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS8 pAb (ATL-HPA066349) at Atlas |
| Documents & Links for Anti ADAMTS8 pAb (ATL-HPA066349) | |
| Datasheet | Anti ADAMTS8 pAb (ATL-HPA066349) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS8 pAb (ATL-HPA066349) |