Description
Product Description
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 4
Gene Name: ADAMTS4
Alternative Gene Name: ADAMTS-2, ADMP-1, KIAA0688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 93%, ENSRNOG00000003538: 92%
Entrez Gene ID: 9507
Uniprot ID: O75173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTS4
Alternative Gene Name: ADAMTS-2, ADMP-1, KIAA0688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006403: 93%, ENSRNOG00000003538: 92%
Entrez Gene ID: 9507
Uniprot ID: O75173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP |
Gene Sequence | ATHILVRQQGNPGHRSIYLALKLPDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQDTRLRYSFFVP |
Gene ID - Mouse | ENSMUSG00000006403 |
Gene ID - Rat | ENSRNOG00000003538 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADAMTS4 pAb (ATL-HPA068374) | |
Datasheet | Anti ADAMTS4 pAb (ATL-HPA068374) Datasheet (External Link) |
Vendor Page | Anti ADAMTS4 pAb (ATL-HPA068374) at Atlas Antibodies |
Documents & Links for Anti ADAMTS4 pAb (ATL-HPA068374) | |
Datasheet | Anti ADAMTS4 pAb (ATL-HPA068374) Datasheet (External Link) |
Vendor Page | Anti ADAMTS4 pAb (ATL-HPA068374) |