Anti ADAMTS19 pAb (ATL-HPA058438)

Atlas Antibodies

Catalog No: ATL-HPA058438-25

• 

Product Description

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 19
Gene Name: ADAMTS19
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053441: 94%, ENSRNOG00000019577: 82%
Entrez Gene ID: 171019
Uniprot ID: Q8TE59
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGYQ
• Gene Sequence: DSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGYQ
• Gene ID - Mouse: ENSMUSG00000053441
• Gene ID - Rat: ENSRNOG00000019577
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.