Anti ADAMTS16 pAb (ATL-HPA067668)

Atlas Antibodies

Catalog No: ATL-HPA067668-25

• 
• 

Product Description

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif 16
Gene Name: ADAMTS16
Alternative Gene Name: ADAMTS16s
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049538: 63%, ENSRNOG00000016812: 61%
Entrez Gene ID: 170690
Uniprot ID: Q8TE57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS
• Gene Sequence: GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS
• Gene ID - Mouse: ENSMUSG00000049538
• Gene ID - Rat: ENSRNOG00000016812
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.