![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100091/179855/atl-hpa067668_anti-adamts16-pab-atl-hpa067668_61518__39240.1681135680.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif 16
Gene Name: ADAMTS16
Alternative Gene Name: ADAMTS16s
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049538: 63%, ENSRNOG00000016812: 61%
Entrez Gene ID: 170690
Uniprot ID: Q8TE57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTS16
Alternative Gene Name: ADAMTS16s
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049538: 63%, ENSRNOG00000016812: 61%
Entrez Gene ID: 170690
Uniprot ID: Q8TE57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS |
| Documents & Links for Anti ADAMTS16 pAb (ATL-HPA067668) | |
| Datasheet | Anti ADAMTS16 pAb (ATL-HPA067668) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS16 pAb (ATL-HPA067668) at Atlas |
| Documents & Links for Anti ADAMTS16 pAb (ATL-HPA067668) | |
| Datasheet | Anti ADAMTS16 pAb (ATL-HPA067668) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS16 pAb (ATL-HPA067668) |