Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif 12
Gene Name: ADAMTS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047497: 76%, ENSRNOG00000018865: 75%
Entrez Gene ID: 81792
Uniprot ID: P58397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAMTS12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047497: 76%, ENSRNOG00000018865: 75%
Entrez Gene ID: 81792
Uniprot ID: P58397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETK |
| Documents & Links for Anti ADAMTS12 pAb (ATL-HPA075079) | |
| Datasheet | Anti ADAMTS12 pAb (ATL-HPA075079) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS12 pAb (ATL-HPA075079) at Atlas |
| Documents & Links for Anti ADAMTS12 pAb (ATL-HPA075079) | |
| Datasheet | Anti ADAMTS12 pAb (ATL-HPA075079) Datasheet (External Link) |
| Vendor Page | Anti ADAMTS12 pAb (ATL-HPA075079) |