Protein Description: ADAM metallopeptidase domain 8
Gene Name: ADAM8
Alternative Gene Name: CD156, CD156a, MS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025473: 75%, ENSRNOG00000017897: 70%
Entrez Gene ID: 101
Uniprot ID: P78325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAM8
Alternative Gene Name: CD156, CD156a, MS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025473: 75%, ENSRNOG00000017897: 70%
Entrez Gene ID: 101
Uniprot ID: P78325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHV |
| Documents & Links for Anti ADAM8 pAb (ATL-HPA064637) | |
| Datasheet | Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link) |
| Vendor Page | Anti ADAM8 pAb (ATL-HPA064637) at Atlas |
| Documents & Links for Anti ADAM8 pAb (ATL-HPA064637) | |
| Datasheet | Anti ADAM8 pAb (ATL-HPA064637) Datasheet (External Link) |
| Vendor Page | Anti ADAM8 pAb (ATL-HPA064637) |