Anti ADAM33 pAb (ATL-HPA067152)

Atlas Antibodies

Catalog No: ATL-HPA067152-25

• 

Product Description

Protein Description: ADAM metallopeptidase domain 33
Gene Name: ADAM33
Alternative Gene Name: C20orf153, dJ964F7.1, DKFZp434K0521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027318: 64%, ENSRNOG00000021242: 64%
Entrez Gene ID: 80332
Uniprot ID: Q9BZ11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD
• Gene Sequence: NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD
• Gene ID - Mouse: ENSMUSG00000027318
• Gene ID - Rat: ENSRNOG00000021242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.