Protein Description: ADAM metallopeptidase domain 33
Gene Name: ADAM33
Alternative Gene Name: C20orf153, dJ964F7.1, DKFZp434K0521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027318: 64%, ENSRNOG00000021242: 64%
Entrez Gene ID: 80332
Uniprot ID: Q9BZ11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAM33
Alternative Gene Name: C20orf153, dJ964F7.1, DKFZp434K0521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027318: 64%, ENSRNOG00000021242: 64%
Entrez Gene ID: 80332
Uniprot ID: Q9BZ11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALALPSAQLD |
| Documents & Links for Anti ADAM33 pAb (ATL-HPA067152) | |
| Datasheet | Anti ADAM33 pAb (ATL-HPA067152) Datasheet (External Link) |
| Vendor Page | Anti ADAM33 pAb (ATL-HPA067152) at Atlas |
| Documents & Links for Anti ADAM33 pAb (ATL-HPA067152) | |
| Datasheet | Anti ADAM33 pAb (ATL-HPA067152) Datasheet (External Link) |
| Vendor Page | Anti ADAM33 pAb (ATL-HPA067152) |