Anti ADAM32 pAb (ATL-HPA062151)

Atlas Antibodies

Catalog No: ATL-HPA062151-25

• 

Product Description

Protein Description: ADAM metallopeptidase domain 32
Gene Name: ADAM32
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037437: 71%, ENSRNOG00000025728: 68%
Entrez Gene ID: 203102
Uniprot ID: Q8TC27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF
• Gene Sequence: LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF
• Gene ID - Mouse: ENSMUSG00000037437
• Gene ID - Rat: ENSRNOG00000025728
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.