Description
Product Description
Protein Description: ADAM metallopeptidase domain 32
Gene Name: ADAM32
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037437: 71%, ENSRNOG00000025728: 68%
Entrez Gene ID: 203102
Uniprot ID: Q8TC27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAM32
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037437: 71%, ENSRNOG00000025728: 68%
Entrez Gene ID: 203102
Uniprot ID: Q8TC27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF |
Gene Sequence | LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF |
Gene ID - Mouse | ENSMUSG00000037437 |
Gene ID - Rat | ENSRNOG00000025728 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADAM32 pAb (ATL-HPA062151) | |
Datasheet | Anti ADAM32 pAb (ATL-HPA062151) Datasheet (External Link) |
Vendor Page | Anti ADAM32 pAb (ATL-HPA062151) at Atlas Antibodies |
Documents & Links for Anti ADAM32 pAb (ATL-HPA062151) | |
Datasheet | Anti ADAM32 pAb (ATL-HPA062151) Datasheet (External Link) |
Vendor Page | Anti ADAM32 pAb (ATL-HPA062151) |