Description
Product Description
Protein Description: ADAM metallopeptidase domain 11
Gene Name: ADAM11
Alternative Gene Name: MDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020926: 95%, ENSRNOG00000002753: 93%
Entrez Gene ID: 4185
Uniprot ID: O75078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAM11
Alternative Gene Name: MDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020926: 95%, ENSRNOG00000002753: 93%
Entrez Gene ID: 4185
Uniprot ID: O75078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR |
Gene Sequence | LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR |
Gene ID - Mouse | ENSMUSG00000020926 |
Gene ID - Rat | ENSRNOG00000002753 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) | |
Datasheet | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) | |
Datasheet | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) |