Protein Description: ADAM metallopeptidase domain 11
Gene Name: ADAM11
Alternative Gene Name: MDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020926: 95%, ENSRNOG00000002753: 93%
Entrez Gene ID: 4185
Uniprot ID: O75078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADAM11
Alternative Gene Name: MDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020926: 95%, ENSRNOG00000002753: 93%
Entrez Gene ID: 4185
Uniprot ID: O75078
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR |
| Documents & Links for Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) | |
| Datasheet | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) at Atlas |
| Documents & Links for Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) | |
| Datasheet | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ADAM11 pAb (ATL-HPA074550 w/enhanced validation) |