Anti ACTR10 pAb (ATL-HPA071251)

Atlas Antibodies

Catalog No: ATL-HPA071251-25

• 
• 

Product Description

Protein Description: actin-related protein 10 homolog (S. cerevisiae)
Gene Name: ACTR10
Alternative Gene Name: ACTR11, Arp10, Arp11, HARP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021076: 94%, ENSRNOG00000007504: 94%
Entrez Gene ID: 55860
Uniprot ID: Q9NZ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK
• Gene Sequence: KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK
• Gene ID - Mouse: ENSMUSG00000021076
• Gene ID - Rat: ENSRNOG00000007504
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.