Anti ACSS3 pAb (ATL-HPA047956 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA047956-25

• 
• 

Product Description

Protein Description: acyl-CoA synthetase short-chain family member 3
Gene Name: ACSS3
Alternative Gene Name: FLJ21963
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035948: 85%, ENSRNOG00000004448: 88%
Entrez Gene ID: 79611
Uniprot ID: Q9H6R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYIL
• Gene Sequence: ASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYIL
• Gene ID - Mouse: ENSMUSG00000035948
• Gene ID - Rat: ENSRNOG00000004448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.