Anti ACP5 pAb (ATL-HPA059463)

Atlas Antibodies

Catalog No: ATL-HPA059463-25

• 

Product Description

Protein Description: acid phosphatase 5, tartrate resistant
Gene Name: ACP5
Alternative Gene Name: TRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001348: 95%, ENSRNOG00000046261: 93%
Entrez Gene ID: 54
Uniprot ID: P13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLG
• Gene Sequence: THCLVKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLG
• Gene ID - Mouse: ENSMUSG00000001348
• Gene ID - Rat: ENSRNOG00000046261
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.