Protein Description: acyl-CoA oxidase 2, branched chain
Gene Name: ACOX2
Alternative Gene Name: BRCACOX, BRCOX, THCCox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021751: 79%, ENSRNOG00000007378: 79%
Entrez Gene ID: 8309
Uniprot ID: Q99424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACOX2
Alternative Gene Name: BRCACOX, BRCOX, THCCox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021751: 79%, ENSRNOG00000007378: 79%
Entrez Gene ID: 8309
Uniprot ID: Q99424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL |
| Documents & Links for Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) | |
| Datasheet | Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) at Atlas |
| Documents & Links for Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) | |
| Datasheet | Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) |
| Citations for Anti ACOX2 pAb (ATL-HPA064845 w/enhanced validation) – 1 Found |
| Alonso-Peña, Marta; Espinosa-Escudero, Ricardo; Herraez, Elisa; Briz, Oscar; Cagigal, Maria Luisa; Gonzalez-Santiago, Jesus M; Ortega-Alonso, Aida; Fernandez-Rodriguez, Conrado; Bujanda, Luis; Calvo Sanchez, Marta; D Avola, Delia; Londoño, Maria-Carlota; Diago, Moises; Fernandez-Checa, Jose C; Garcia-Ruiz, Carmen; Andrade, Raul J; Lammert, Frank; Prieto, Jesus; Crespo, Javier; Juamperez, Javier; Diaz-Gonzalez, Alvaro; Monte, Maria J; Marin, Jose J G. Beneficial effect of ursodeoxycholic acid in patients with acyl-CoA oxidase 2 (ACOX2) deficiency-associated hypertransaminasemia. Hepatology (Baltimore, Md.). 2022;76(5):1259-1274. PubMed |