Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation)

Catalog No:
ATL-HPA000288-100
$505.00
Protein Description: angiotensin I converting enzyme 2
Gene Name: ACE2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015405: 74%, ENSRNOG00000031665: 46%
Entrez Gene ID: 59272
Uniprot ID: Q9BYF1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED

Documents & Links for Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation)
Datasheet Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation) at Atlas

Documents & Links for Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation)
Datasheet Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation)

Citations for Anti ACE2 pAb (ATL-HPA000288 w/enhanced validation) – 35 Found
Ullah, Irfan; Prévost, Jérémie; Ladinsky, Mark S; Stone, Helen; Lu, Maolin; Anand, Sai Priya; Beaudoin-Bussières, Guillaume; Symmes, Kelly; Benlarbi, Mehdi; Ding, Shilei; Gasser, Romain; Fink, Corby; Chen, Yaozong; Tauzin, Alexandra; Goyette, Guillaume; Bourassa, Catherine; Medjahed, Halima; Mack, Matthias; Chung, Kunho; Wilen, Craig B; Dekaban, Gregory A; Dikeakos, Jimmy D; Bruce, Emily A; Kaufmann, Daniel E; Stamatatos, Leonidas; McGuire, Andrew T; Richard, Jonathan; Pazgier, Marzena; Bjorkman, Pamela J; Mothes, Walther; Finzi, Andrés; Kumar, Priti; Uchil, Pradeep D. Live imaging of SARS-CoV-2 infection in mice reveals that neutralizing antibodies require Fc function for optimal efficacy. Immunity. 2021;54(9):2143-2158.e15.  PubMed
Choi, Yohan; Jeon, Hayce; Brännström, Mats; Akin, James W; Curry, Thomas E Jr; Jo, Misung. Ovulatory upregulation of angiotensin-converting enzyme 2, a receptor for SARS-CoV-2, in dominant follicles of the human ovary. Fertility And Sterility. 2021;116(6):1631-1640.  PubMed
Haga, Kei; Takai-Todaka, Reiko; Matsumura, Yuta; Song, Chihong; Takano, Tomomi; Tojo, Takuto; Nagami, Atsushi; Ishida, Yuki; Masaki, Hidekazu; Tsuchiya, Masayuki; Ebisudani, Toshiki; Sugimoto, Shinya; Sato, Toshiro; Yasuda, Hiroyuki; Fukunaga, Koichi; Sawada, Akihito; Nemoto, Naoto; Murata, Kazuyoshi; Morimoto, Takuya; Katayama, Kazuhiko. Nasal delivery of single-domain antibody improves symptoms of SARS-CoV-2 infection in an animal model. Plos Pathogens. 2021;17(10):e1009542.  PubMed
Schurink, Bernadette; Roos, Eva; Vos, Wim; Breur, Marjolein; van der Valk, Paul; Bugiani, Marianna. ACE2 Protein Expression During Childhood, Adolescence, and Early Adulthood. Pediatric And Developmental Pathology : The Official Journal Of The Society For Pediatric Pathology And The Paediatric Pathology Society. 2022;25(4):404-408.  PubMed
Peng, Yang; Wang, Zhao-Ni; Chen, Shi-Ying; Xu, Ai-Ru; Fang, Zhang-Fu; Sun, Jing; Zhou, Zi-Qing; Hou, Xiao-Tao; Cen, Lai-Jian; Ma, Jian-Juan; Zhao, Jin-Cun; Guan, Wei-Jie; Wang, De-Yun; Zhong, Nan-Shan. Angiotensin-converting enzyme 2 in peripheral lung club cells modulates the susceptibility to SARS-CoV-2 in chronic obstructive pulmonary disease. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2022;322(5):L712-L721.  PubMed
Pinto, Andreia L; Rai, Ranjit K; Brown, Jonathan C; Griffin, Paul; Edgar, James R; Shah, Anand; Singanayagam, Aran; Hogg, Claire; Barclay, Wendy S; Futter, Clare E; Burgoyne, Thomas. Ultrastructural insight into SARS-CoV-2 entry and budding in human airway epithelium. Nature Communications. 2022;13(1):1609.  PubMed
Lee, Hyuk-Joon; Nam, Ki Taek; Park, Heae Surng; Kim, Min A; Lafleur, Bonnie J; Aburatani, Hiroyuki; Yang, Han-Kwang; Kim, Woo Ho; Goldenring, James R. Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer. Gastroenterology. 2010;139(1):213-25.e3.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Alawi, Laale F; Emberesh, Sana E; Owuor, Brenda A; Chodavarapu, Harshita; Fadnavis, Rucha; El-Amouri, Salim S; Elased, Khalid M. Effect of hyperglycemia and rosiglitazone on renal and urinary neprilysin in db/db diabetic mice. Physiological Reports. 2020;8(3):e14364.  PubMed
Dai, Yu-Jun; Hu, Fang; Li, Huan; Huang, Han-Ying; Wang, Da-Wei; Liang, Yang. A profiling analysis on the receptor ACE2 expression reveals the potential risk of different type of cancers vulnerable to SARS-CoV-2 infection. Annals Of Translational Medicine. 2020;8(7):481.  PubMed
Fu, Jiewen; Zhou, Baixu; Zhang, Lianmei; Balaji, Kyathegowdanadoddi Srinivasa; Wei, Chunli; Liu, Xiaoyan; Chen, Hanchun; Peng, Jiangzhou; Fu, Junjiang. Expressions and significances of the angiotensin-converting enzyme 2 gene, the receptor of SARS-CoV-2 for COVID-19. Molecular Biology Reports. 2020;47(6):4383-4392.  PubMed
Duijf, Pascal H G. Low baseline pulmonary levels of cytotoxic lymphocytes as a predisposing risk factor for severe COVID-19. Biorxiv : The Preprint Server For Biology. 2020; 32511391( 32511391)  PubMed
Lee, Ivan T; Nakayama, Tsuguhisa; Wu, Chien-Ting; Goltsev, Yury; Jiang, Sizun; Gall, Phillip A; Liao, Chun-Kang; Shih, Liang-Chun; Schürch, Christian M; McIlwain, David R; Chu, Pauline; Borchard, Nicole A; Zarabanda, David; Dholakia, Sachi S; Yang, Angela; Kim, Dayoung; Kanie, Tomoharu; Lin, Chia-Der; Tsai, Ming-Hsui; Phillips, Katie M; Kim, Raymond; Overdevest, Jonathan B; Tyler, Matthew A; Yan, Carol H; Lin, Chih-Feng; Lin, Yi-Tsen; Bau, Da-Tian; Tsay, Gregory J; Patel, Zara M; Tsou, Yung-An; Tai, Chih-Jaan; Yeh, Te-Huei; Hwang, Peter H; Nolan, Garry P; Nayak, Jayakar V; Jackson, Peter K. Robust ACE2 protein expression localizes to the motile cilia of the respiratory tract epithelia and is not increased by ACE inhibitors or angiotensin receptor blockers. Medrxiv : The Preprint Server For Health Sciences. 2020; 32511516( 32511516)  PubMed
Hikmet, Feria; Méar, Loren; Edvinsson, Åsa; Micke, Patrick; Uhlén, Mathias; Lindskog, Cecilia. The protein expression profile of ACE2 in human tissues. Molecular Systems Biology. 2020;16(7):e9610.  PubMed
Huang, Xin; He, Chaobin; Hua, Xin; Kan, Anna; Sun, Shuxin; Wang, Jun; Li, Shengping. Bioinformatic Analysis of Correlation between Immune Infiltration and COVID-19 in Cancer Patients. International Journal Of Biological Sciences. 16(13):2464-2476.  PubMed
Krueger, James G; Murrell, Dedee F; Garcet, Sandra; Navrazhina, Kristina; Lee, Patricia C; Muscianisi, Elisa; Blauvelt, Andrew. Secukinumab lowers expression of ACE2 in affected skin of patients with psoriasis. The Journal Of Allergy And Clinical Immunology. 2021;147(3):1107-1109.e2.  PubMed
Barker, Harlan; Parkkila, Seppo. Bioinformatic characterization of angiotensin-converting enzyme 2, the entry receptor for SARS-CoV-2. Plos One. 15(10):e0240647.  PubMed
Lee, Ivan T; Nakayama, Tsuguhisa; Wu, Chien-Ting; Goltsev, Yury; Jiang, Sizun; Gall, Phillip A; Liao, Chun-Kang; Shih, Liang-Chun; Schürch, Christian M; McIlwain, David R; Chu, Pauline; Borchard, Nicole A; Zarabanda, David; Dholakia, Sachi S; Yang, Angela; Kim, Dayoung; Chen, Han; Kanie, Tomoharu; Lin, Chia-Der; Tsai, Ming-Hsui; Phillips, Katie M; Kim, Raymond; Overdevest, Jonathan B; Tyler, Matthew A; Yan, Carol H; Lin, Chih-Feng; Lin, Yi-Tsen; Bau, Da-Tian; Tsay, Gregory J; Patel, Zara M; Tsou, Yung-An; Tzankov, Alexandar; Matter, Matthias S; Tai, Chih-Jaan; Yeh, Te-Huei; Hwang, Peter H; Nolan, Garry P; Nayak, Jayakar V; Jackson, Peter K. ACE2 localizes to the respiratory cilia and is not increased by ACE inhibitors or ARBs. Nature Communications. 2020;11(1):5453.  PubMed
Zamorano Cuervo, Natalia; Grandvaux, Nathalie. ACE2: Evidence of role as entry receptor for SARS-CoV-2 and implications in comorbidities. Elife. 2020;9( 33164751)  PubMed
Blair, Robert V; Vaccari, Monica; Doyle-Meyers, Lara A; Roy, Chad J; Russell-Lodrigue, Kasi; Fahlberg, Marissa; Monjure, Chris J; Beddingfield, Brandon; Plante, Kenneth S; Plante, Jessica A; Weaver, Scott C; Qin, Xuebin; Midkiff, Cecily C; Lehmicke, Gabrielle; Golden, Nadia; Threeton, Breanna; Penney, Toni; Allers, Carolina; Barnes, Mary B; Pattison, Melissa; Datta, Prasun K; Maness, Nicholas J; Birnbaum, Angela; Fischer, Tracy; Bohm, Rudolf P; Rappaport, Jay. Acute Respiratory Distress in Aged, SARS-CoV-2-Infected African Green Monkeys but Not Rhesus Macaques. The American Journal Of Pathology. 2021;191(2):274-282.  PubMed
Kusmartseva, Irina; Wu, Wenting; Syed, Farooq; Van Der Heide, Verena; Jorgensen, Marda; Joseph, Paul; Tang, Xiaohan; Candelario-Jalil, Eduardo; Yang, Changjun; Nick, Harry; Harbert, Jack L; Posgai, Amanda L; Paulsen, John David; Lloyd, Richard; Cechin, Sirlene; Pugliese, Alberto; Campbell-Thompson, Martha; Vander Heide, Richard S; Evans-Molina, Carmella; Homann, Dirk; Atkinson, Mark A. Expression of SARS-CoV-2 Entry Factors in the Pancreas of Normal Organ Donors and Individuals with COVID-19. Cell Metabolism. 2020;32(6):1041-1051.e6.  PubMed
Coate, Katie C; Cha, Jeeyeon; Shrestha, Shristi; Wang, Wenliang; Gonçalves, Luciana Mateus; Almaça, Joana; Kapp, Meghan E; Fasolino, Maria; Morgan, Ashleigh; Dai, Chunhua; Saunders, Diane C; Bottino, Rita; Aramandla, Radhika; Jenkins, Regina; Stein, Roland; Kaestner, Klaus H; Vahedi, Golnaz; Brissova, Marcela; Powers, Alvin C. SARS-CoV-2 Cell Entry Factors ACE2 and TMPRSS2 Are Expressed in the Microvasculature and Ducts of Human Pancreas but Are Not Enriched in β Cells. Cell Metabolism. 2020;32(6):1028-1040.e4.  PubMed
Lamers, Mart M; van der Vaart, Jelte; Knoops, Kèvin; Riesebosch, Samra; Breugem, Tim I; Mykytyn, Anna Z; Beumer, Joep; Schipper, Debby; Bezstarosti, Karel; Koopman, Charlotte D; Groen, Nathalie; Ravelli, Raimond B G; Duimel, Hans Q; Demmers, Jeroen A A; Verjans, Georges M G M; Koopmans, Marion P G; Muraro, Mauro J; Peters, Peter J; Clevers, Hans; Haagmans, Bart L. An organoid-derived bronchioalveolar model for SARS-CoV-2 infection of human alveolar type II-like cells. The Embo Journal. 2021;40(5):e105912.  PubMed
Wang, Weiqi; Lv, Silin; Gan, Wenqiang; Zeng, Zifan; Yang, Min. A bioinformatics analysis on the potential role of ACE2 in cardiac impairment of patients with coronavirus disease 2019. Annals Of Translational Medicine. 2020;8(21):1403.  PubMed
Heuberger, Julian; Trimpert, Jakob; Vladimirova, Daria; Goosmann, Christian; Lin, Manqiang; Schmuck, Rosa; Mollenkopf, Hans-Joachim; Brinkmann, Volker; Tacke, Frank; Osterrieder, Nikolaus; Sigal, Michael. Epithelial response to IFN-γ promotes SARS-CoV-2 infection. Embo Molecular Medicine. 2021;13(4):e13191.  PubMed
Kwan, Jennifer Yin Yee; Lin, Liang-Tzung; Bell, Rachel; Bruce, Jeffrey P; Richardson, Christopher; Pugh, Trevor J; Liu, Fei-Fei. Elevation in viral entry genes and innate immunity compromise underlying increased infectivity and severity of COVID-19 in cancer patients. Scientific Reports. 2021;11(1):4533.  PubMed
Alawi, Laale F; Dhakal, Sanjeev; Emberesh, Sana E; Sawant, Harshal; Hosawi, Anhar; Thanekar, Unmesha; Grobe, Nadja; Elased, Khalid M. Effects of Angiotensin II Type 1A Receptor on ACE2, Neprilysin and KIM-1 in Two Kidney One Clip (2K1C) Model of Renovascular Hypertension. Frontiers In Pharmacology. 11( 33708117):602985.  PubMed
Ottaiano, Alessandro; Scala, Stefania; D'Alterio, Crescenzo; Trotta, Annamaria; Bello, Annamaria; Rea, Giuseppina; Picone, Carmine; Santorsola, Mariachiara; Petrillo, Antonella; Nasti, Guglielmo. Unexpected tumor reduction in metastatic colorectal cancer patients during SARS-Cov-2 infection. Therapeutic Advances In Medical Oncology. 13( 33995596):17588359211011455.  PubMed
Martin, Gottfried; Wolf, Julian; Lapp, Thabo; Agostini, Hansjürgen T; Schlunck, Günther; Auw-Hädrich, Claudia; Lange, Clemens A K. Viral S protein histochemistry reveals few potential SARS-CoV-2 entry sites in human ocular tissues. Scientific Reports. 2021;11(1):19140.  PubMed
Ramasamy, Santhamani; Kolloli, Afsal; Kumar, Ranjeet; Husain, Seema; Soteropoulos, Patricia; Chang, Theresa L; Subbian, Selvakumar. Comprehensive Analysis of Disease Pathology in Immunocompetent and Immunocompromised Hosts following Pulmonary SARS-CoV-2 Infection. Biomedicines. 2022;10(6)  PubMed
Abdillah, Dimas Arya; Kereilwe, Onalenna; Ferdousy, Raihana Nasrin; Saito, Risa; Kadokawa, Hiroya. Spike protein of SARS-CoV-2 suppresses gonadotrophin secretion from bovine anterior pituitaries. The Journal Of Reproduction And Development. 2022;68(2):152-159.  PubMed
Kawano, Hiroaki; Motokawa, Tetsufumi; Kurohama, Hirokazu; Okano, Shinji; Akashi, Ryohei; Yonekura, Tsuyoshi; Ikeda, Satoshi; Izumikawa, Koichi; Maemura, Koji. Fulminant Myocarditis 24 Days after Coronavirus Disease Messenger Ribonucleic Acid Vaccination. Internal Medicine (Tokyo, Japan). 2022;61(15):2319-2325.  PubMed
Choong, Oi Kuan; Jakobsson, Rasmus; Bergdahl, Anna Grenabo; Brunet, Sofia; Kärmander, Ambjörn; Waldenström, Jesper; Arvidsson, Yvonne; Altiparmak, Gülay; Nilsson, Jonas A; Karlsson, Joakim; Nyström, Kristina; Johansson, Martin E. SARS-CoV-2 replicates and displays oncolytic properties in clear cell and papillary renal cell carcinoma. Plos One. 18(1):e0279578.  PubMed
Louise, Reveret; Manon, Leclerc; Vincent, Emond; Andréanne, Loiselle; Philippe, Bourassa; Cyntia, Tremblay; Bennett, David A; Sébastien, Hébert; Frédéric, Calon. Higher Angiotensin I Converting Enzyme 2 (ACE2) levels in the brain of individuals with Alzheimer's disease. Biorxiv : The Preprint Server For Biology. 2023; 36711734( 36711734)  PubMed
Stocker, Nino; Radzikowska, Urszula; Wawrzyniak, Paulina; Tan, Ge; Huang, Mengting; Ding, Mei; Akdis, Cezmi A; Sokolowska, Milena. Regulation of angiotensin-converting enzyme 2 isoforms by type 2 inflammation and viral infection in human airway epithelium. Mucosal Immunology. 2023;16(1):5-16.  PubMed